PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF004600010CFD_t1
Common NameTRAES_3BF004600010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 121aa    MW: 13510.2 Da    PI: 6.9328
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF004600010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB118.23.9e-371781794
                    NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                             mk vlP +ak+sk+ake++qec++efi+fvt+eas++c+re+rkt+ngdd+++a++tlG+++y+ +++ yl++yre e
  TRAES3BF004600010CFD_t1  1 MKDVLPPEAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVNGDDICHAMTTLGLDNYAGAMRRYLQRYREGE 78
                             89*************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.2E-33181IPR009072Histone-fold
SuperFamilySSF471131.84E-25182IPR009072Histone-fold
PfamPF008083.6E-17155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-141937No hitNo description
PRINTSPR006151.7E-143856No hitNo description
PRINTSPR006151.7E-145775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MKDVLPPEAK VSKHAKEVIQ ECATEFIGFV TGEASERCRR ERRKTVNGDD ICHAMTTLGL  60
DNYAGAMRRY LQRYREGEEL AAVLNNHSRS PAPPAPGDGM IQIDVWGELS NSRGNEKHGR  120
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-311761792Transcription factor HapC (Eurofung)
4g92_B5e-311761792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690868.11e-54PREDICTED: transcriptional activator hap3-like
SwissprotO040279e-35NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A077RZV01e-87A0A077RZV0_WHEAT; Uncharacterized protein
STRINGMLOC_79487.14e-79(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.15e-36nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]